Lineage for d1i9pa_ (1i9p A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1804999Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1805000Protein Carbonic anhydrase [51071] (10 species)
  7. 1805038Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (555 PDB entries)
    Uniprot P00918
  8. 1805477Domain d1i9pa_: 1i9p A: [62097]
    complexed with hg, ioe, zn

Details for d1i9pa_

PDB Entry: 1i9p (more details), 1.92 Å

PDB Description: carbonic anhydrase ii (f131v) complexed with 4-(aminosulfonyl)-n-[(2, 4,6-trifluorophenyl)methyl]-benzamide
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1i9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9pa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d1i9pa_:

Click to download the PDB-style file with coordinates for d1i9pa_.
(The format of our PDB-style files is described here.)

Timeline for d1i9pa_: