SCOP 1.73: Domain d1i9na_: 1i9n A:

Lineage for d1i9na_ (1i9n A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (197 PDB entries)

8. Domain d1i9na_: 1i9n A: [62095]
   complexed with hg, ioa, zn; mutant

Details for d1i9na_

PDB Entry: 1i9n, 1.86 Å

PDB Description: carbonic anhydrase ii (f131v) complexed with 4-(aminosulfonyl)-n-[(2, 5-difluorophenyl)methyl]-benzamide

PDB Compounds: (A:) carbonic anhydrase II

SCOP Domain Sequences for d1i9na_:

Sequence; same for both SEQRES and ATOM records:

>d1i9na_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d1i9na_:

• d1i9na_ first appeared in SCOP 1.57
  
• d1i9na_ appears in SCOP 1.71
  
• d1i9na_ appears in SCOP 1.75
  
• d1i9na_ appears in the current release, SCOPe 2.08