Lineage for d1i9la_ (1i9l A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63199Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
  4. 63200Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 63201Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 63202Protein Carbonic anhydrase [51071] (9 species)
  7. 63217Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (143 PDB entries)
  8. 63305Domain d1i9la_: 1i9l A: [62093]

Details for d1i9la_

PDB Entry: 1i9l (more details), 1.93 Å

PDB Description: carbonic anhydrase ii (f131v) complexed with 4-(aminosulfonyl)-n-[(4- fluorophenyl)methyl]-benzamide

SCOP Domain Sequences for d1i9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9la_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOP Domain Coordinates for d1i9la_:

Click to download the PDB-style file with coordinates for d1i9la_.
(The format of our PDB-style files is described here.)

Timeline for d1i9la_: