Lineage for d1i9ga_ (1i9g A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1864764Family c.66.1.13: tRNA(1-methyladenosine) methyltransferase-like [64117] (5 proteins)
    contains additional N-terminal beta-sandwich domain
  6. 1864774Protein Probable methyltransferase Rv2118c [64118] (1 species)
  7. 1864775Species Mycobacterium tuberculosis [TaxId:1773] [64119] (1 PDB entry)
  8. 1864776Domain d1i9ga_: 1i9g A: [62090]
    structural genomics
    complexed with sam

Details for d1i9ga_

PDB Entry: 1i9g (more details), 1.98 Å

PDB Description: crystal structure of an adomet dependent methyltransferase
PDB Compounds: (A:) hypothetical protein rv2118c

SCOPe Domain Sequences for d1i9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}
tgpfsigervqltdakgrrytmsltpgaefhthrgsiahdavigleqgsvvkssngalfl
vlrpllvdyvmsmprgpqviypkdaaqivhegdifpgarvleagagsgaltlsllravgp
agqvisyeqradhaeharrnvsgcygqppdnwrlvvsdladselpdgsvdravldmlapw
evldavsrllvaggvlmvyvatvtqlsrivealrakqcwteprawetlqrgwnvvglavr
pqhsmrghtaflvatrrlapgava

SCOPe Domain Coordinates for d1i9ga_:

Click to download the PDB-style file with coordinates for d1i9ga_.
(The format of our PDB-style files is described here.)

Timeline for d1i9ga_: