SCOPe 2.05: Domain d1i9be_: 1i9b E:

Lineage for d1i9be_ (1i9b E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)

8. Domain d1i9be_: 1i9b E: [62088]
   complexed with ca, epe

Details for d1i9be_

PDB Entry: 1i9b, 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)

PDB Compounds: (E:) acetylcholine binding protein

SCOPe Domain Sequences for d1i9be_:

Sequence; same for both SEQRES and ATOM records:

>d1i9be_ b.96.1.1 (E:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Timeline for d1i9be_:

• d1i9be_ first appeared in SCOP 1.57
  
• d1i9be_ appears in SCOPe 2.04
  
• d1i9be_ is called d1i9be1 in SCOPe 2.06
  
• d1i9be_ appears in the current release, SCOPe 2.08, called d1i9be1