Lineage for d1i9be_ (1i9b E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 64226Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
  4. 64227Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family) (S)
  5. 64228Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (1 protein)
  6. 64229Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 64230Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (1 PDB entry)
  8. 64235Domain d1i9be_: 1i9b E: [62088]

Details for d1i9be_

PDB Entry: 1i9b (more details), 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)

SCOP Domain Sequences for d1i9be_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9be_ b.96.1.1 (E:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis)}
fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

SCOP Domain Coordinates for d1i9be_:

Click to download the PDB-style file with coordinates for d1i9be_.
(The format of our PDB-style files is described here.)

Timeline for d1i9be_: