Lineage for d1i9bd_ (1i9b D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471913Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 471914Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family) (S)
  5. 471915Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (1 protein)
  6. 471916Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 471917Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (4 PDB entries)
  8. 471961Domain d1i9bd_: 1i9b D: [62087]

Details for d1i9bd_

PDB Entry: 1i9b (more details), 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)

SCOP Domain Sequences for d1i9bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9bd_ b.96.1.1 (D:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis)}
fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

SCOP Domain Coordinates for d1i9bd_:

Click to download the PDB-style file with coordinates for d1i9bd_.
(The format of our PDB-style files is described here.)

Timeline for d1i9bd_: