SCOP 1.67: Domain d1i9bd_: 1i9b D:

Lineage for d1i9bd_ (1i9b D:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (1 protein)

6. Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (4 PDB entries)

8. Domain d1i9bd_: 1i9b D: [62087]

Details for d1i9bd_

PDB Entry: 1i9b, 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)

SCOP Domain Sequences for d1i9bd_:

Sequence; same for both SEQRES and ATOM records:

>d1i9bd_ b.96.1.1 (D:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis)}
fdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Timeline for d1i9bd_:

• d1i9bd_ first appeared in SCOP 1.57
  
• d1i9bd_ appears in SCOP 1.65
  
• d1i9bd_ appears in SCOP 1.69
  
• d1i9bd_ appears in the current release, SCOPe 2.08, called d1i9bd1