SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1i9bb1 (1i9b B:2-205)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073794Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2073795Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)
  8. 2073863Domain d1i9bb1: 1i9b B:2-205 [62085]
    Other proteins in same PDB: d1i9ba2, d1i9bb2, d1i9bc2, d1i9bd2, d1i9be2
    complexed with ca, epe

Details for d1i9bb1

PDB Entry: 1i9b (more details), 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp)
PDB Compounds: (B:) acetylcholine binding protein

SCOPe Domain Sequences for d1i9bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9bb1 b.96.1.1 (B:2-205) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d1i9bb1:

Click to download the PDB-style file with coordinates for d1i9bb1.
(The format of our PDB-style files is described here.)

Timeline for d1i9bb1: