Lineage for d1i9ab_ (1i9a B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609724Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 609725Superfamily d.113.1: Nudix [55811] (5 families) (S)
  5. 609818Family d.113.1.2: IPP isomerase-like [64369] (2 proteins)
  6. 609822Protein Isopentenyl diphosphate isomerase [64370] (1 species)
  7. 609823Species Escherichia coli [TaxId:562] [64371] (11 PDB entries)
  8. 609843Domain d1i9ab_: 1i9a B: [62083]
    complexed with mn

Details for d1i9ab_

PDB Entry: 1i9a (more details), 2.5 Å

PDB Description: structural studies of cholesterol biosynthesis: mevalonate 5- diphosphate decarboxylase and isopentenyl diphosphate isomerase

SCOP Domain Sequences for d1i9ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9ab_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftql

SCOP Domain Coordinates for d1i9ab_:

Click to download the PDB-style file with coordinates for d1i9ab_.
(The format of our PDB-style files is described here.)

Timeline for d1i9ab_: