SCOP 1.59: Domain d1i9ab_: 1i9a B:

Lineage for d1i9ab_ (1i9a B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)

4. Superfamily d.113.1: Nudix [55811] (2 families)

5. Family d.113.1.2: Isopentenyl diphosphate isomerase [64369] (1 protein)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (3 PDB entries)

8. Domain d1i9ab_: 1i9a B: [62083]

Details for d1i9ab_

PDB Entry: 1i9a, 2.5 Å

PDB Description: structural studies of cholesterol biosynthesis: mevalonate 5- diphosphate decarboxylase and isopentenyl diphosphate isomerase

SCOP Domain Sequences for d1i9ab_:

Sequence; same for both SEQRES and ATOM records:

>d1i9ab_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftql

Timeline for d1i9ab_:

• d1i9ab_ first appeared in SCOP 1.57
  
• d1i9ab_ appears in SCOP 1.61
  
• d1i9ab_ appears in the current release, SCOPe 2.08