![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) |
![]() | Protein Isopentenyl diphosphate isomerase [64370] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [64371] (18 PDB entries) Uniprot Q46822 |
![]() | Domain d1i9ab_: 1i9a B: [62083] complexed with mn |
PDB Entry: 1i9a (more details), 2.5 Å
SCOPe Domain Sequences for d1i9ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9ab_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftql
Timeline for d1i9ab_: