SCOP 1.73: Domain d1i9aa_: 1i9a A:

Lineage for d1i9aa_ (1i9a A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (7 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (3 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (16 PDB entries)

8. Domain d1i9aa_: 1i9a A: [62082]

Details for d1i9aa_

PDB Entry: 1i9a, 2.5 Å

PDB Description: structural studies of cholesterol biosynthesis: mevalonate 5- diphosphate decarboxylase and isopentenyl diphosphate isomerase

PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOP Domain Sequences for d1i9aa_:

Sequence; same for both SEQRES and ATOM records:

>d1i9aa_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftql

Timeline for d1i9aa_:

• d1i9aa_ first appeared in SCOP 1.57
  
• d1i9aa_ appears in SCOP 1.71
  
• d1i9aa_ appears in SCOP 1.75
  
• d1i9aa_ appears in the current release, SCOPe 2.08