Lineage for d1i9aa_ (1i9a A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83309Fold d.113: Nudix [55810] (1 superfamily)
  4. 83310Superfamily d.113.1: Nudix [55811] (2 families) (S)
  5. 83327Family d.113.1.2: Isopentenyl diphosphate isomerase [64369] (1 protein)
  6. 83328Protein Isopentenyl diphosphate isomerase [64370] (1 species)
  7. 83329Species Escherichia coli [TaxId:562] [64371] (3 PDB entries)
  8. 83333Domain d1i9aa_: 1i9a A: [62082]

Details for d1i9aa_

PDB Entry: 1i9a (more details), 2.5 Å

PDB Description: structural studies of cholesterol biosynthesis: mevalonate 5- diphosphate decarboxylase and isopentenyl diphosphate isomerase

SCOP Domain Sequences for d1i9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9aa_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftql

SCOP Domain Coordinates for d1i9aa_:

Click to download the PDB-style file with coordinates for d1i9aa_.
(The format of our PDB-style files is described here.)

Timeline for d1i9aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i9ab_