SCOPe 2.04: Domain d1i97s_: 1i97 S:

Lineage for d1i97s_ (1i97 S:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)
   automatically mapped to Pfam PF00203

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
   Uniprot P80381

8. Domain d1i97s_: 1i97 S: [62077]
   Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97t_, d1i97u_
   complexed with mg, tac, wo2, zn

Details for d1i97s_

PDB Entry: 1i97, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1i97s_:

Sequence; same for both SEQRES and ATOM records:

>d1i97s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1i97s_:

• d1i97s_ first appeared in SCOP 1.57
  
• d1i97s_ appears in SCOPe 2.03
  
• d1i97s_ appears in SCOPe 2.05
  
• d1i97s_ appears in the current release, SCOPe 2.08