Lineage for d1i97s_ (1i97 S:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410293Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 410294Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 410295Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 410296Protein Ribosomal protein S19 [54572] (1 species)
  7. 410297Species Thermus thermophilus [TaxId:274] [54573] (16 PDB entries)
  8. 410311Domain d1i97s_: 1i97 S: [62077]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97s_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1i97s_:

Click to download the PDB-style file with coordinates for d1i97s_.
(The format of our PDB-style files is described here.)

Timeline for d1i97s_: