Lineage for d1i97r_ (1i97 R:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 439259Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 439260Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 439261Protein Ribosomal protein S18 [46913] (1 species)
  7. 439262Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries)
  8. 439274Domain d1i97r_: 1i97 R: [62076]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97r_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
kpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqril
aktikrarilgllpfteklvrk

SCOP Domain Coordinates for d1i97r_:

Click to download the PDB-style file with coordinates for d1i97r_.
(The format of our PDB-style files is described here.)

Timeline for d1i97r_: