Lineage for d1i97q_ (1i97 Q:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166908Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (15 proteins)
  6. 166978Protein Ribosomal protein S17 [50304] (2 species)
  7. 166981Species Thermus thermophilus [TaxId:274] [50305] (10 PDB entries)
  8. 166990Domain d1i97q_: 1i97 Q: [62075]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97q_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeerykvgdvveiie
arpiskrkrfrvlrlveegrldlvekylvrrqnyaslskrggka

SCOP Domain Coordinates for d1i97q_:

Click to download the PDB-style file with coordinates for d1i97q_.
(The format of our PDB-style files is described here.)

Timeline for d1i97q_: