Lineage for d1i97q_ (1i97 Q:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (13 proteins) 
Protein Ribosomal protein S17 [50304] (2 species) Species Thermus thermophilus [TaxId:274] [50305] (10 PDB entries) 
Domain d1i97q_: 1i97 Q: [62075]
Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
Details for d1i97q_
PDB Entry: 1i97 (more details), 4.5 Å
PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline
SCOP Domain Sequences for d1i97q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeerykvgdvveiie
arpiskrkrfrvlrlveegrldlvekylvrrqnyaslskrggka
SCOP Domain Coordinates for d1i97q_:
Click to download the PDB-style file with coordinates for d1i97q_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i97q_:
- d1i97q_ first appeared in SCOP 1.57
- d1i97q_ appears in SCOP 1.61
- d1i97q_ appears in the current release, SCOPe 2.08
View in 3D
