Lineage for d1i97p_ (1i97 P:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327467Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 327468Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 327469Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 327470Protein Ribosomal protein S16 [54567] (1 species)
  7. 327471Species Thermus thermophilus [TaxId:274] [54568] (15 PDB entries)
  8. 327484Domain d1i97p_: 1i97 P: [62074]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97p_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

SCOP Domain Coordinates for d1i97p_:

Click to download the PDB-style file with coordinates for d1i97p_.
(The format of our PDB-style files is described here.)

Timeline for d1i97p_: