SCOP 1.61: Domain d1i97o_: 1i97 O:

Lineage for d1i97o_ (1i97 O:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)

6. Protein Ribosomal protein S15 [47065] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (14 PDB entries)

8. Domain d1i97o_: 1i97 O: [62073]
   Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97o_

PDB Entry: 1i97, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97o_:

Sequence; same for both SEQRES and ATOM records:

>d1i97o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d1i97o_:

• d1i97o_ first appeared in SCOP 1.57
  
• d1i97o_ appears in SCOP 1.59
  
• d1i97o_ appears in SCOP 1.63
  
• d1i97o_ appears in the current release, SCOPe 2.08