Lineage for d1i97n_ (1i97 N:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523848Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 523849Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families) (S)
  5. 524006Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 524007Protein Ribosomal protein S14 [57753] (1 species)
  7. 524008Species Thermus thermophilus [TaxId:274] [57754] (14 PDB entries)
  8. 524020Domain d1i97n_: 1i97 N: [62072]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97n_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1i97n_:

Click to download the PDB-style file with coordinates for d1i97n_.
(The format of our PDB-style files is described here.)

Timeline for d1i97n_: