Lineage for d1i97m_ (1i97 M:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650278Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 650279Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 650280Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  6. 650281Protein Ribosomal protein S13 [46948] (1 species)
  7. 650282Species Thermus thermophilus [TaxId:274] [46949] (36 PDB entries)
  8. 650308Domain d1i97m_: 1i97 M: [62071]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97m_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline
PDB Compounds: (M:) 30S ribosomal protein S13

SCOP Domain Sequences for d1i97m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97m_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrr

SCOP Domain Coordinates for d1i97m_:

Click to download the PDB-style file with coordinates for d1i97m_.
(The format of our PDB-style files is described here.)

Timeline for d1i97m_: