Lineage for d1i97m_ (1i97 M:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 95624Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 95675Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) (S)
  5. 95676Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)
  6. 95677Protein Ribosomal protein S13 [46948] (1 species)
  7. 95678Species Thermus thermophilus [TaxId:274] [46949] (10 PDB entries)
  8. 95687Domain d1i97m_: 1i97 M: [62071]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97m_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97m_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrr

SCOP Domain Coordinates for d1i97m_:

Click to download the PDB-style file with coordinates for d1i97m_.
(The format of our PDB-style files is described here.)

Timeline for d1i97m_: