SCOPe 2.06: Domain d1i97l_: 1i97 L:

Lineage for d1i97l_ (1i97 L:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
   Uniprot P17293

8. Domain d1i97l_: 1i97 L: [62070]
   Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
   complexed with mg, tac, wo2, zn

Details for d1i97l_

PDB Entry: 1i97, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1i97l_:

Sequence; same for both SEQRES and ATOM records:

>d1i97l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkeaaktaakk

Timeline for d1i97l_:

• d1i97l_ first appeared in SCOP 1.57
  
• d1i97l_ appears in SCOPe 2.05
  
• d1i97l_ appears in SCOPe 2.07
  
• d1i97l_ appears in the current release, SCOPe 2.08