![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein S11 [53141] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [53142] (37 PDB entries) |
![]() | Domain d1i97k_: 1i97 K: [62069] Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_ complexed with mg, tac, wo2, zn |
PDB Entry: 1i97 (more details), 4.5 Å
SCOP Domain Sequences for d1i97k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} kkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaal daakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr kas
Timeline for d1i97k_: