Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Thermus thermophilus [TaxId:274] [56051] (15 PDB entries) |
Domain d1i97h_: 1i97 H: [62066] Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_ |
PDB Entry: 1i97 (more details), 4.5 Å
SCOP Domain Sequences for d1i97h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus} mltdpiadmltrirnatrvykestevpasrfkeeilkilaregfikgyervevdgkpylr ihlkygprrqgpdprpeqvikhirrisrpgrrvyvgvkeiprvrrglgiailstpkgvlt drearklgvggelicevw
Timeline for d1i97h_: