Lineage for d1i97h_ (1i97 H:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84186Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
  4. 84187Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 84188Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 84189Protein Ribosomal protein S8 [56049] (3 species)
  7. 84196Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries)
  8. 84207Domain d1i97h_: 1i97 H: [62066]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97h_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestevpasrfkeeilkilaregfikgyervevdgkpylr
ihlkygprrqgpdprpeqvikhirrisrpgrrvyvgvkeiprvrrglgiailstpkgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1i97h_:

Click to download the PDB-style file with coordinates for d1i97h_.
(The format of our PDB-style files is described here.)

Timeline for d1i97h_: