SCOP 1.71: Domain d1i97e2: 1i97 E:2-73

Lineage for d1i97e2 (1i97 E:2-73)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.50: dsRBD-like [54767] (4 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
   lacks the N-terminal helix

7. Species Thermus thermophilus [TaxId:274] [54781] (18 PDB entries)

8. Domain d1i97e2: 1i97 E:2-73 [62063]
   Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
   complexed with mg, tac, wo2, zn

Details for d1i97e2

PDB Entry: 1i97, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97e2:

Sequence; same for both SEQRES and ATOM records:

>d1i97e2 d.50.1.2 (E:2-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy
arrnmvevplqn

Timeline for d1i97e2:

• d1i97e2 first appeared in SCOP 1.57
  
• d1i97e2 appears in SCOP 1.69
  
• d1i97e2 appears in SCOP 1.73
  
• d1i97e2 appears in the current release, SCOPe 2.08