Lineage for d1i97e2 (1i97 E:2-73)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503301Fold d.50: dsRBD-like [54767] (4 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 503302Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 503330Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 503331Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
    lacks the N-terminal helix
  7. 503334Species Thermus thermophilus [TaxId:274] [54781] (14 PDB entries)
  8. 503346Domain d1i97e2: 1i97 E:2-73 [62063]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97e2

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97e2 d.50.1.2 (E:2-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy
arrnmvevplqn

SCOP Domain Coordinates for d1i97e2:

Click to download the PDB-style file with coordinates for d1i97e2.
(The format of our PDB-style files is described here.)

Timeline for d1i97e2: