Lineage for d1i97e1 (1i97 E:74-157)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1636637Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1636680Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 1636708Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. Domain d1i97e1: 1i97 E:74-157 [62062]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97e1

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1i97e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97e1 d.14.1.1 (E:74-157) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkgeah

SCOPe Domain Coordinates for d1i97e1:

Click to download the PDB-style file with coordinates for d1i97e1.
(The format of our PDB-style files is described here.)

Timeline for d1i97e1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i97e2