Lineage for d1i97c1 (1i97 C:2-106)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503440Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 503467Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 503468Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 503477Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)
  7. 503478Species Thermus thermophilus [TaxId:274] [54817] (14 PDB entries)
  8. 503490Domain d1i97c1: 1i97 C:2-106 [62059]
    Other proteins in same PDB: d1i97b_, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97c1

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1i97c1:

Click to download the PDB-style file with coordinates for d1i97c1.
(The format of our PDB-style files is described here.)

Timeline for d1i97c1: