SCOP 1.59: Domain d1i97c1: 1i97 C:2-106

Lineage for d1i97c1 (1i97 C:2-106)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)

4. Superfamily d.52.3: Prokaryotic type KH domain (pKH-domain) [54814] (1 family)

5. Family d.52.3.1: Prokaryotic type KH domain (pKH-domain) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries)

8. Domain d1i97c1: 1i97 C:2-106 [62059]
   Other proteins in same PDB: d1i97b_, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97c1

PDB Entry: 1i97, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97c1:

Sequence; same for both SEQRES and ATOM records:

>d1i97c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d1i97c1:

• d1i97c1 first appeared in SCOP 1.57
  
• d1i97c1 appears in SCOP 1.61
  
• d1i97c1 appears in the current release, SCOPe 2.08