| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies) |
Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) ![]() |
| Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins) |
| Protein Ribosomal protein S3 N-terminal domain [54816] (1 species) |
| Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries) |
| Domain d1i97c1: 1i97 C:2-106 [62059] Other proteins in same PDB: d1i97b_, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_ |
PDB Entry: 1i97 (more details), 4.5 Å
SCOP Domain Sequences for d1i97c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1i97c1: