Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) fold elaborated with additional structures |
Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
Protein Ribosomal protein S2 [52315] (3 species) |
Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
Domain d1i97b_: 1i97 B: [62058] Other proteins in same PDB: d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_ complexed with mg, tac, wo2, zn |
PDB Entry: 1i97 (more details), 4.5 Å
SCOPe Domain Sequences for d1i97b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe aeatetpeg
Timeline for d1i97b_: