Lineage for d1i97b_ (1i97 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579458Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 579459Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 579460Protein Ribosomal protein S2 [52315] (2 species)
  7. 579470Species Thermus thermophilus [TaxId:274] [52316] (18 PDB entries)
  8. 579486Domain d1i97b_: 1i97 B: [62058]
    Other proteins in same PDB: d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97b_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl
amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal
faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf
ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe
aeatetpeg

SCOP Domain Coordinates for d1i97b_:

Click to download the PDB-style file with coordinates for d1i97b_.
(The format of our PDB-style files is described here.)

Timeline for d1i97b_: