Lineage for d1i96v_ (1i96 V:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258489Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 258490Superfamily d.68.1: Translation initiation factor IF3, C-terminal domain [55200] (1 family) (S)
  5. 258491Family d.68.1.1: Translation initiation factor IF3, C-terminal domain [55201] (1 protein)
  6. 258492Protein Translation initiation factor IF3, C-terminal domain [55202] (3 species)
  7. 258497Species Thermus thermophilus [TaxId:274] [64306] (1 PDB entry)
  8. 258498Domain d1i96v_: 1i96 V: [62057]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_
    complexed to 30S ribosomal subunit; CA-atoms only
    complexed with mg, wo2, zn

Details for d1i96v_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96v_ d.68.1.1 (V:) Translation initiation factor IF3, C-terminal domain {Thermus thermophilus}
evksikfrvkidehdyqtklghikrflqeghkvkvtimfrgrevahpelgerilnrvted
lkdlavvemkpemlgrdmnmllapvk

SCOP Domain Coordinates for d1i96v_:

Click to download the PDB-style file with coordinates for d1i96v_.
(The format of our PDB-style files is described here.)

Timeline for d1i96v_: