SCOP 1.71: Domain d1i96s_: 1i96 S:

Lineage for d1i96s_ (1i96 S:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (20 PDB entries)

8. Domain d1i96s_: 1i96 S: [62054]
   Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96t_, d1i96u_, d1i96v_
   complexed with mg, wo2, zn

Details for d1i96s_

PDB Entry: 1i96, 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96s_:

Sequence; same for both SEQRES and ATOM records:

>d1i96s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1i96s_:

• d1i96s_ first appeared in SCOP 1.57
  
• d1i96s_ appears in SCOP 1.69
  
• d1i96s_ appears in SCOP 1.73
  
• d1i96s_ appears in the current release, SCOPe 2.08