SCOPe 2.04: Domain d1i96o_: 1i96 O:

Lineage for d1i96o_ (1i96 O:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array
4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit
   automatically mapped to Pfam PF00312

6. Protein Ribosomal protein S15 [47065] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
   Uniprot P80378

8. Domain d1i96o_: 1i96 O: [62050]
   Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
   complexed with mg, wo2, zn

Details for d1i96o_

PDB Entry: 1i96, 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1i96o_:

Sequence; same for both SEQRES and ATOM records:

>d1i96o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d1i96o_:

• d1i96o_ first appeared in SCOP 1.57
  
• d1i96o_ appears in SCOPe 2.03
  
• d1i96o_ appears in SCOPe 2.05
  
• d1i96o_ appears in the current release, SCOPe 2.08