Lineage for d1i96o_ (1i96 O:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534943Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 534944Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 534951Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 534952Protein Ribosomal protein S15 [47065] (2 species)
  7. 534955Species Thermus thermophilus [TaxId:274] [47067] (23 PDB entries)
  8. 534973Domain d1i96o_: 1i96 O: [62050]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96o_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1i96o_:

Click to download the PDB-style file with coordinates for d1i96o_.
(The format of our PDB-style files is described here.)

Timeline for d1i96o_: