Lineage for d1i96n_ (1i96 N:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90358Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 90359Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 90452Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 90453Protein Ribosomal protein S14 [57753] (1 species)
  7. 90454Species Thermus thermophilus [TaxId:274] [57754] (10 PDB entries)
  8. 90462Domain d1i96n_: 1i96 N: [62049]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_

Details for d1i96n_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1i96n_:

Click to download the PDB-style file with coordinates for d1i96n_.
(The format of our PDB-style files is described here.)

Timeline for d1i96n_: