Lineage for d1i96j_ (1i96 J:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412753Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 412754Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 412755Protein Ribosomal protein S10 [55001] (1 species)
  7. 412756Species Thermus thermophilus [TaxId:274] [55002] (14 PDB entries)
  8. 412766Domain d1i96j_: 1i96 J: [62045]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96j_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1i96j_:

Click to download the PDB-style file with coordinates for d1i96j_.
(The format of our PDB-style files is described here.)

Timeline for d1i96j_: