![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() |
![]() | Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
![]() | Protein Ribosomal protein S10 [55001] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55002] (10 PDB entries) |
![]() | Domain d1i96j_: 1i96 J: [62045] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ |
PDB Entry: 1i96 (more details), 4.2 Å
SCOP Domain Sequences for d1i96j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus} kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d1i96j_: