Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries) Uniprot P80374 |
Domain d1i96i_: 1i96 I: [62044] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ complexed with mg, wo2, zn |
PDB Entry: 1i96 (more details), 4.2 Å
SCOPe Domain Sequences for d1i96i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d1i96i_: