Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (3 species) |
Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries) |
Domain d1i96h_: 1i96 H: [62043] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ |
PDB Entry: 1i96 (more details), 4.2 Å
SCOP Domain Sequences for d1i96h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus} mltdpiadmltrirnatrvykestevpasrfkeeilkilaregfikgyervevdgkpylr ihlkygprrqgpdprpeqvikhirrisrpgrrvyvgvkeiprvrrglgiailstpkgvlt drearklgvggelicevw
Timeline for d1i96h_: