![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
![]() | Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
![]() | Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
![]() | Protein Ribosomal protein S7 [47975] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries) Uniprot P17291 |
![]() | Domain d1i96g_: 1i96 G: [62042] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ complexed with mg, wo2, zn |
PDB Entry: 1i96 (more details), 4.2 Å
SCOPe Domain Sequences for d1i96g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]} arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d1i96g_: