SCOPe 2.04: Domain d1i96f_: 1i96 F:

Lineage for d1i96f_ (1i96 F:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
   Uniprot P23370

8. Domain d1i96f_: 1i96 F: [62041]
   Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
   complexed with mg, wo2, zn

Details for d1i96f_

PDB Entry: 1i96, 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1i96f_:

Sequence; same for both SEQRES and ATOM records:

>d1i96f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

Timeline for d1i96f_:

• d1i96f_ first appeared in SCOP 1.57
  
• d1i96f_ appears in SCOPe 2.03
  
• d1i96f_ appears in SCOPe 2.05
  
• d1i96f_ appears in the current release, SCOPe 2.08