![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
![]() | Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) automatically mapped to Pfam PF00333 |
![]() | Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
![]() | Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) Uniprot P27152 |
PDB Entry: 1i96 (more details), 4.2 Å
SCOPe Domain Sequences for d1i96e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96e2 d.50.1.2 (E:2-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy arrnmvevplqn
Timeline for d1i96e2: