Lineage for d1i96e2 (1i96 E:2-73)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025346Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1025347Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 1025422Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 1025423Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 1025451Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
    Uniprot P27152
  8. 1025475Domain d1i96e2: 1i96 E:2-73 [62040]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96e2

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1i96e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96e2 d.50.1.2 (E:2-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy
arrnmvevplqn

SCOPe Domain Coordinates for d1i96e2:

Click to download the PDB-style file with coordinates for d1i96e2.
(The format of our PDB-style files is described here.)

Timeline for d1i96e2: