Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.50: dsRBD-like [54767] (3 superfamilies) |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) |
Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species) |
Species Thermus thermophilus [TaxId:274] [54781] (10 PDB entries) |
Domain d1i96e2: 1i96 E:2-73 [62040] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ |
PDB Entry: 1i96 (more details), 4.2 Å
SCOP Domain Sequences for d1i96e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96e2 d.50.1.2 (E:2-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus} petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy arrnmvevplqn
Timeline for d1i96e2: