Lineage for d1i96e2 (1i96 E:2-73)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79728Fold d.50: dsRBD-like [54767] (3 superfamilies)
  4. 79729Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) (S)
  5. 79746Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 79747Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
  7. 79750Species Thermus thermophilus [TaxId:274] [54781] (10 PDB entries)
  8. 79758Domain d1i96e2: 1i96 E:2-73 [62040]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_

Details for d1i96e2

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96e2 d.50.1.2 (E:2-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
petdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyy
arrnmvevplqn

SCOP Domain Coordinates for d1i96e2:

Click to download the PDB-style file with coordinates for d1i96e2.
(The format of our PDB-style files is described here.)

Timeline for d1i96e2: